SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901719|ref|NP_001079659| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901719|ref|NP_001079659|
Domain Number 1 Region: 125-224
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-17
Family I set domains 0.0028
Further Details:      
 
Domain Number 2 Region: 28-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000263
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147901719|ref|NP_001079659|
Sequence length 289
Comment similar to junctional adhesion molecule 1 [Xenopus laevis]
Sequence
MATAGNSRRAVGVGLLCCCLWTVTLAAVTTPNPTIIVKEGESAELQCSYSSDFTSPRVEW
KFVNKDQETSFVFYDGSLTAPYKDRAIPYPQGITLKQITRKDAGEYSCEVTSTGSKTLYG
EAKIQLQVIVAPSKPVAQVPRSVSTGSVAELLCVENDGYPPPTFIWYRNKSPMQIAPQNS
TYTIDPKTGVLKFAAVSTSDSGEYYCEATNNQGKQASDLVRMDVQDVNVGGIVAAVVIVL
LILALIGFGMWFAYSRGYLDRKENKKVIYSLPSETRSDKNFQQTSSFLV
Download sequence
Identical sequences Q7ZWT0
NP_001079659.1.7800 gi|147901719|ref|NP_001079659| gi|28436858|gb|AAH46720|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]