SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901829|ref|NP_001082342| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901829|ref|NP_001082342|
Domain Number 1 Region: 399-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.18e-77
Family Eukaryotic proteases 0.0000991
Further Details:      
 
Domain Number 2 Region: 22-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.0000178
Further Details:      
 
Domain Number 3 Region: 182-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.0000179
Further Details:      
 
Domain Number 4 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000114
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 132-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147901829|ref|NP_001082342|
Sequence length 717
Comment mannose-binding lectin-associated serine protease-3a [Xenopus laevis]
Sequence
MRIPLLFSICLWMLSEAEAIQLTDMFGEIRTPNFPDSYPSDSEVTWNITVPEGFRLKLYF
MHFDLEPSYLCEYDYAKVESEDQVIANFCGKESTDTEQAPGQQIITSPSNFLSLTFRSDF
SNEERFTGFDAHYSAIDIDECTEKSDEDLVCDHHCHNYIGGFYCSCRFGYLLHTDNRTCK
VECSDNLFTQRSGLISSPDYPGPYAKSSDCRYRIQLEEGFVINLHFDDNFYVEDHPEVKC
PYDYLKIKTGKKEFGPLCGEKSPGRIETGSNSVQILFHSDNSGENGGWRLSYSVTGMPCP
NLHPPMNGKLEPPQSEYTFKDQVVISCNQGYRVLKDNVEMESLQIECRKDGTWSNQIPPC
QIVDCKKPKEIENGFITYSTAENRTTYQSSFNYSCREPYYMMVPNITLVYTCDASGEWTS
QEIGAKIPTCQPVCGKPARPLPGIVKRIIGGRNAEPGFFPWQVLIVVEDLSRVPMNKWFG
GGALISDSWVLTAAHNLRSQRRDNTVMPVAKEHVTVYLGLHDVRSKTDAVNRTIEKIILH
EMFDPESYNHDIALVKLNEKVIMNQYVMPVCLPKLEHELEGPQPNTLGLVAGWGISDPNI
TVDEVISSGMRTHSAILQYVKLPVVLHAVCKESYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFIMQDTDTKRWVAQGLVSWGGPEECGSKQVYGVYTKVSNFVDWVDDNLKS
Download sequence
Identical sequences Q8AXR1
gi|147901829|ref|NP_001082342| gi|26005767|gb|BAC41339| NP_001082342.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]