SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901992|ref|NP_001084284| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901992|ref|NP_001084284|
Domain Number 1 Region: 103-249
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.32e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.00000147
Further Details:      
 
Domain Number 2 Region: 30-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000389
Family Glutathione S-transferase (GST), N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147901992|ref|NP_001084284|
Sequence length 252
Comment chloride intracellular channel 4 [Xenopus laevis]
Sequence
MSLSVPQNGVQADKDNLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKR
KPADLQNLAPGTHPPFITYNHEVKTDVNKVEEFLEEVLCPPKYRKLAAKHPESNTAGMDI
FAKFSAYIKNSRPENNEALERGLLKTLQKLDDYLDSPLPDEIDENSMDDIIQSNRKFLDG
EEMTLADCNLLPKLHIIKVVTKKYRGFEIPKSMAGIWRYLSNAYSRDEFTNTCPGDREIE
IAYADVAKQLAK
Download sequence
Identical sequences Q6GQF7
NP_001084284.1.7800 gi|147901992|ref|NP_001084284| gi|49119104|gb|AAH72787|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]