SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147903110|ref|NP_001082340| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147903110|ref|NP_001082340|
Domain Number 1 Region: 406-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-76
Family Eukaryotic proteases 0.0000937
Further Details:      
 
Domain Number 2 Region: 22-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-31
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 3 Region: 182-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-30
Family Spermadhesin, CUB domain 0.0000143
Further Details:      
 
Domain Number 4 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 5 Region: 133-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000914
Family EGF-type module 0.0017
Further Details:      
 
Domain Number 6 Region: 362-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000967
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147903110|ref|NP_001082340|
Sequence length 717
Comment mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) [Xenopus laevis]
Sequence
MRIPLLFSICLWMLSEAEVIQLTDMFGEIRTPNFPDSYPSESEVTWNITVPEGFRLKLYF
MHFDLEPSYLCEYDYAKVETEDQVIATFCGKESTDKEQAPGQRIITSPGNFLSLTFRSDF
SNEERFTGFDAHYSAKDIDECTEKSDEDLVCDHHCHNYIGGFYCFCRFGYLLHTDNRTCK
VECSDNLFTQRSGFISSPDYPSPYPKSSNCRYRIKLEEGFVINLHFDDSFDVEDHPQVTC
PYDFVKIKSGKKEFGPLCGEKSPGTIETGSNSVQILFNSDNSGENGGWRLSYSATGAPCP
NLHPPINGKLEPSQSEYIFKDQVVVSCNQGYQVLKNNVEMESFQIECRKDGTWSNQIPPC
QIVDCRTPKEIENGFITYPTADNHTTYQSSFNYSCREPYYIMVPNITSVYTCDSNGEWTS
QEIEAKIPTCQPACGKPTQPLPGIVKRIIGGRNAEPGFFPWQVLIVVEDLSRVPMNKWFG
GGALISDSWVLTAAHNLRSQRRDNTVMPVSKEHVTIYLGLHDVQSKTDSVNRTIEKIILH
EMFDPESYNHDIALVKLNEKVIMNQYVMPVCLPEFEHELEGPQPNTLGLVAGWGISSANI
TVEEVISSDIRTHSAILQYVKLPVVLHAVCKESYESRSGNYSVTENMFCAGYYEGGKDTC
FGDSGGAFIMQDTDTKRWVAQGLVSWGGPEECGSKQVYGVYTKVSNFVDWVDDKLKS
Download sequence
Identical sequences Q8AXR0
gi|147903110|ref|NP_001082340| gi|26005769|gb|BAC41340| NP_001082340.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]