SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147905173|ref|NP_001079984| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147905173|ref|NP_001079984|
Domain Number 1 Region: 262-398,433-642
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.26e-89
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000328
Further Details:      
 
Domain Number 2 Region: 648-815
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 4.3e-37
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00012
Further Details:      
 
Domain Number 3 Region: 80-185
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.88e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 
Domain Number 4 Region: 845-898
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000000746
Family a tRNA synthase domain 0.0026
Further Details:      
 
Domain Number 5 Region: 399-433
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000562
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|147905173|ref|NP_001079984|
Domain Number - Region: 1-67
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00212
Family Glutathione S-transferase (GST), N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147905173|ref|NP_001079984|
Sequence length 905
Comment hypothetical protein LOC379675 [Xenopus laevis]
Sequence
MKLFVGEGNPQGVKVLAAAALWAQHVQIDRLQQEEKIVPFMSQPRLPVLDLENGNYLFLS
NAICRYFYLSSGHDMCDLSNQWLEWEAAELQPALSAALYAHVVQGKKKEDVMATISASLK
HLDQSLAGKSSPYLIKDALTVVDIVVWGSIYPLIVDASNLPEEMASLKRWFQNVSQLEQC
QKAASSLLKDKGSSVFKPFLQKQPAPITPPGKSVCKEQEGEDMPSLSEEDIQAAAEAWAK
GLTGASKPKQRPHPILPVEGEKNVLITSALPYVNNVPHLGNIIGSVLSADVFARYCRLRN
WNTLYICGTDEYGTATETKAMEEGLTPQQICDKYNAIHTAIYQWFNISFDYFGRTTTQHQ
TTISQDIFHRLLEREFLLTDTVEQLRCEKCQRFLADRFVEGICPFCNYEEARGDQCDKCG
KLINAVELKKPQCKICKQSPVIKSSKHLFLDLPKLEKRLEQWLEQSFSTGDWTSNARFIT
RSWIRDGLKPRCITRDLKWGTPVPLDGFRDKVFYVWFDAPIGYISITANYTDQWEKWWKS
PQQVQLYNFMAKDNVPFHSVVFPSCLLGAEDNYTLVNHLVATEYLNYEDGKFSKSRGVGV
FGDMAKDTGIPADIWRFYLLYVRPEGQDSAFSWSDLMLKNNSELLNNLGNFVNRAGMFVQ
KFFNGCVPEMELLSEDKRLLAQVAAELQQYNLLLEKVRIRDALRCILNISRHGNQYIQVN
EPWKCIKGNQQEQKRAGTVTGVAVNMAALLSIMLHPYMPTISSVIQEQLLMPQESKVLTT
DFCCCLQSGHQIGNVSPLFQKLENDQIESLRKRFGGGQVKTESKVSPSQEAPEQQAPKAS
GPERVKELMQELEKQGNHVRELKGKKAEKSVIDPEVQKLLALKKELALAEGKSPDPPTQK
GKKKK
Download sequence
Identical sequences Q6PF21
NP_001079984.1.7800 gi|147905173|ref|NP_001079984| gi|34785909|gb|AAH57757| gi|82187134|sp|Q6PF21|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]