SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147906059|ref|NP_001087780| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147906059|ref|NP_001087780|
Domain Number 1 Region: 33-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000107
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147906059|ref|NP_001087780|
Sequence length 193
Comment V-set and transmembrane domain containing 2 like [Xenopus laevis]
Sequence
MGAWGLSLGVLHCLGVYIQLSAGETQSSTDALFTETPHDVSAHPGEDVEMACSFRGSGDI
PYSLEIQWWYMRTHRDWANKETWAENQLKSLPGTPEKGATKISIVKVFGSNISHKLRLSN
VKISDEGTYECRVLDYSDGKGRQHRVKAFLRVEAEMGRRGVISHRQQDTGPHRHFPGKEL
KKRAAVPCEQCQL
Download sequence
Identical sequences Q642P8
gi|147906059|ref|NP_001087780| gi|51895940|gb|AAH81214| NP_001087780.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]