SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147906889|ref|NP_001087777| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147906889|ref|NP_001087777|
Domain Number 1 Region: 33-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-35
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 2 Region: 155-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 359-480
Classification Level Classification E-value
Superfamily TIMP-like 3.14e-27
Family Netrin-like domain (NTR/C345C module) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147906889|ref|NP_001087777|
Sequence length 480
Comment procollagen C-endopeptidase enhancer [Xenopus laevis]
Sequence
MSPTLLLCLSLVLGLCRAQNSDTNNYTRPVFLCGGDFTGDSGFIASEGFPNNYPPNKKCL
WKITVPDGHVVMLTFRLLDMEADPSCRYDYLNIYNGHSEKGQRLARVCGTFRPGALLSTG
PQMMLEMVTDEGTGGRGFVVWYTAGSTQPTESQICGGKLEKPQGSINTPNWPENNYPSGT
SCSWHIVAPKEKVVELSFGKFDVEGDSYCRYDYLAVFNGGQSDNTRLIGKFCGDSPPKTI
YSDGNEMLVQFVSDLSVTADGFAANYRMRDASDVPKTKPTSKPTSTGATDKKAPLDTKLS
KKPTAKPILKTTAKPILKTTVKPTMKAKPTKAEKLATTPKPKTKPTKLPKSPGSSSAVKC
PLKCRKSGSLGSHYCANQFVVTGTVNALTQGDSEKSLLATVTIIKTYKVEGLSIQGSGKT
MSIKVINECPKCPILKKGSSYLFMGEVNAEGQGRIVPESFVIGYKVAQHQFLTAISKKPC
Download sequence
Identical sequences Q66IT1
NP_001087777.1.7800 gi|147906889|ref|NP_001087777| gi|51703591|gb|AAH81211|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]