SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147907242|ref|NP_001088439| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147907242|ref|NP_001088439|
Domain Number 1 Region: 276-475,639-858,896-927
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.38e-132
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000279
Further Details:      
 
Domain Number 2 Region: 929-1184
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.25e-56
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00012
Further Details:      
 
Domain Number 3 Region: 492-640
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 4.97e-56
Family ValRS/IleRS/LeuRS editing domain 0.0000396
Further Details:      
 
Domain Number 4 Region: 75-187
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.78e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 
Weak hits

Sequence:  gi|147907242|ref|NP_001088439|
Domain Number - Region: 1175-1237
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.000732
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147907242|ref|NP_001088439|
Sequence length 1243
Comment valyl-tRNA synthetase [Xenopus laevis]
Sequence
MSTLYVPNTTSSDPRCLWVRIAGQYSTQNKPKVQEVSSGPQGLPLPCLLSSSNGSVWGSW
AVSYLLVPEALSGGCDPRSCALVKQWVSYAESELLPAVYGAERSQNNERSLLELQKILDN
LDCYLKLRTYLVGEIITLADIAVACCLISPYTKVLSPTRREKLLNVTRWFLTCVNQKQFK
EILGEVNLLKTDVATLNTSNGPSGSPISGPPKTAAQLKKESKKKEKLERFQQKQEKIKEQ
KGEKKPKPEKKDKKEIGVITYDIPTPAGEKKDVSGPMPDSYSPQYVESAWYSWWEKEKFF
KPEFGRSSVSEPSPKGVFMMCIPPPNVTGSLHLGHALTNAIQDCLTRWHRMRGELTLWNP
GCDHAGIATQVVVEKKLWRERGKNRHDLGRENFIEEVWKWKREKGDRIYHQLRILGSSLD
WDRACFTMDPKLSFAVQEAFIRLHEAGIIYRSKRLVNWSCTLNSAISDIEVDKKELSGRT
LLPVPGYKQGVEFGVLVSFAYKVQETGEEIVVATTRVETMLGDTAVAVHPQDQRYKHLKG
HHVVHPFCSRLLPIVFDEFVDMNFGTGAVKITPAHDPTDYDVGMRHSLDFVNIMDDDGTL
VNVPPPFLGMKRFDARKAVLAALKEKGFFKEVKDNPMVVPVCSRSKDIVEPLLKPQWYVR
CDEMGKRAADAVRDGHLEIKPEFHTKTWFSWMDNIRDWCISRQLWWGHRIPAYFVTVNDP
SVPAGEDTDGKYWISGRSEQEAKEKAARVFNVAAEKISLRQDEDVLDTWFSSGIFPFSIF
GWPNQTEDLQVFYPGTLLETGHDILFFWVARMVMLGLTLTGKLPFKEVYLHAVVRDAHGR
KMSKSLGNVIDPLDVINGITLEGLHKQLLESNLDPAELERAKDGQKYDYPNGIPECGTDA
LRFALCAYTSQGRDINLDVNRILGYRHFCNKIWNATKFAMRSLGDNFSPPDFAGACGQES
LADRWILSRLSIAVDLCNTGFQNYDFPGITTAVYNFWLYELCDVYLECLKPVFLSSDETA
ISVGRNTLYTCLDVGLRLLSPFMPFLTEELYQRLPRRPSSRTPSISVTSYPETSDYNLRD
EEVERNMDLVLLIIKSIRSLRADYNLTKTKADCFVQCQDADTVSVVTAYTPYITVLSSSR
SLVALKAEDPSPAGSAVNTASDKATVYVVLKGLIDVEKELAKLQVKKSELGRQLEKLRER
MGSADYRSKVPETVQQQDADRIRQLETEFRKVNEAAENFQKMV
Download sequence
Identical sequences Q5U5C2
gi|147907242|ref|NP_001088439| gi|54311439|gb|AAH84762| NP_001088439.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]