SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147907330|ref|NP_001086015| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147907330|ref|NP_001086015|
Domain Number 1 Region: 268-411
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 154-252
Classification Level Classification E-value
Superfamily LCCL domain 3.92e-24
Family LCCL domain 0.001
Further Details:      
 
Domain Number 3 Region: 38-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-22
Family Spermadhesin, CUB domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147907330|ref|NP_001086015|
Sequence length 713
Comment discoidin, CUB and LCCL domain containing 1 [Xenopus laevis]
Sequence
MALGRGVCWVQPVTGILALLGISVTIPPLLVAETLGDGCGHVMLYEESGTLASKNYPGTY
PNQTLCEITLKVKTGKNLYIMLADVDIESRDCESAYLKIFKGTSSEEIASYCGDQSTIPK
EIFLNTNKATIRFESGIHVSGRGFLLNYASSDHPDLITCLARSNHYKDKDYSRYCPAGCK
DVAGDISGDVLEGYRDTSLLCKAAIHAGIIADELGGQIQVNQHKGISRYRGFLANGILSK
DGSLSDRRIVFSSPDCSLSLTPGFGKDRFSATSSYHWNTETGEIMSWLPERAQLNTPGIS
WASDNQSSREWLEIDLGDKRRITGIVTTGSTLPNFNYYVKSYIISFRRDGSKWKLYKGAV
SNEEKRLDGNLNYLERARNNFIPPIVARYLRITPQTWNERIALKVELVGCHLAPTHNSST
HPMWKKTSDLSKKPPVTEEKAITELVPAEESNLGWKIFAIIVPIALAACVLIAGVCFCAT
RSRKLKTEAYKSPEEKNGGCWKPLDQPIVRQQSTEFIISYNNDQDPPQKFDLVKCDMEDY
QQPAMIGTGLVTRKGSTFKPMDTDTNETSGTQEIENHYDCPHRNRHQYPLPLTISKPEYA
TPIIERHLIRGNTFTSESGYNVPVISLDRQNSFSAVSFSISTSPENSGRDYQTAHCINTE
ECDYDRPKVYSGWTAIGNDEYQKPQICSMVADGYSSPRDCLKPINQTAITSLL
Download sequence
Identical sequences Q6GN18
gi|147907330|ref|NP_001086015| gi|49116037|gb|AAH73703| NP_001086015.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]