SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148222035|ref|NP_001089604| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148222035|ref|NP_001089604|
Domain Number 1 Region: 105-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000215
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 31-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000318
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148222035|ref|NP_001089604|
Sequence length 270
Comment basigin (Ok blood group) [Xenopus laevis]
Sequence
MGLGLLTLPAVLLLLCGRRTECTDPDITTNAVYMSEKTVILSCNLSVNSLIVSGHRWLKG
SKVLHEDKDTSNVMTYNVTGLPGDGSGQYTCEFLTTPDVRMVVNVSVSPQVLHLKASEHG
NEGDTGVLTCQSNSFPPVTDWAWYIVSPNAVEVIGNGSSDRYVIKSTGNQTVLRISNVDI
EKDQNEYTCNATNELGTGGDVIHFKVRSRLAALWPFLGIVGEVVVLVTIIFIYEKRRKPD
EVCEDEDSATGALKSNSGANNDNLRQRNSN
Download sequence
Identical sequences Q4FZV9
NP_001089604.1.7800 gi|148222035|ref|NP_001089604| gi|71051159|gb|AAH99064|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]