SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148223177|ref|NP_001086316| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148223177|ref|NP_001086316|
Domain Number 1 Region: 203-474
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-72
Family Eukaryotic proteases 0.0000113
Further Details:      
 
Domain Number 2 Region: 18-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-28
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 3 Region: 141-216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148223177|ref|NP_001086316|
Sequence length 476
Comment complement component 1, r subcomponent [Xenopus laevis]
Sequence
MWHYLVLLLGAVVCSQNSNNSPLSGTITSPNYPKLYPNFNESTWDINVPEGYHVSLNFSV
FDIEPSENCSCGFVKVMADGKELGHFCGPMNSSAHPGNRQFVSQGNQMTIHFQSNFSEEM
DGGIIPYKGFQAFYQAIVVICEDPPVLTNGQYKFLTAPGNLEYKSVIQYQCNSPYYYMVT
PNGSDTFSCSAQRDWRDEHGGDKIPRCRPVCGKPENPVTSFGRILHGKKAEPGNFPWQVY
VSRYGTAGGALIGEQWVLTAAQVLPDNVEKQDLNDVLVYMGSLNMKNLMEMDTYPVEAFY
MHPNFNRNNYDNDIALIRLKNPVVMNQNVSPICLPSPEDEDDIYQKDRVGYVSGYGKTEN
HKVANELHYVSVPVASRQACKTYLNKKRPAIRYPSDEDKYLFSRNMFCAGFPEGSLNKGD
SCSGDSGGAYTSQNRQDTWVATGLVSWGFSCGQGYGFYTKVSNYVDWIKSYVGEDA
Download sequence
Identical sequences Q6GLK4
gi|148223177|ref|NP_001086316| gi|49256373|gb|AAH74475| NP_001086316.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]