SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148223329|ref|NP_001088914| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148223329|ref|NP_001088914|
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-38
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 4.71e-36
Family Link domain 0.00000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148223329|ref|NP_001088914|
Sequence length 266
Comment tumor necrosis factor, alpha-induced protein 6 [Xenopus laevis]
Sequence
MKTMIFLVLVFLDETFGWGFKNGVLHNSIWLEQAAGVYHRESRNGKYKLTYREAKAVCEY
EGGRLATYEQLEAARQIGFHVCAAGWLHKGRVGYPIVKPTFNCGFGKKGIIDYGFRLNKS
ERWDAYCYNPHAKECGGVLTEQERIIKSPGYPDHYENDQICYWHIRVNYGQRIFIEFLDL
DIEEDIDCLSDYFEIYDSYDDLHGLVGRYCGYELPDRIISTGNVMTLKFLSDGSVIGGGF
QIKYTAVDSERNETNASSEPYNEFEY
Download sequence
Identical sequences Q5I051
gi|148223329|ref|NP_001088914| gi|56970684|gb|AAH88707| NP_001088914.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]