SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148223573|ref|NP_001079631| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148223573|ref|NP_001079631|
Domain Number 1 Region: 163-270
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-39
Family Link domain 0.0022
Further Details:      
 
Domain Number 2 Region: 275-358
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-27
Family Link domain 0.0013
Further Details:      
 
Domain Number 3 Region: 51-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000689
Family V set domains (antibody variable domain-like) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148223573|ref|NP_001079631|
Sequence length 359
Comment hyaluronan and proteoglycan link protein 3 [Xenopus laevis]
Sequence
MLAEFAVILLVASVCKGLPFYNGFYYEHILNNKTNNGNGEVIHFNGVRLVVNTPDDPLFG
YRGGNVTLPCTFHYEPKLNSTRRHRVKWSKLHKDNTKERDVMVAIGLRHRSFGEYKGRVH
LIQNKPNEVSLVITDLRLEDYGNYKCEVIDGLEDESGIVELELRGVVFPYQPHGGRYQLN
FHDAKKACEDQDAMMASFEQLFKAWEEGLDWCNAGWLMDGTVQYPITLPREPCGGKETAP
GVRSYGERHKQLHRYDAFCFSSALKGKVYYLEHPENMNYAEAKAACQDDGAQIAKVGQLF
AAWKFIDLDRCDAGWLDDGSVRYPIAFPRPNCGPPEPGVRSFGFPTRHMKFGVYCYKMS
Download sequence
Identical sequences Q7ZX17
gi|148223573|ref|NP_001079631| gi|28277320|gb|AAH46259| NP_001079631.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]