SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148224802|ref|NP_001085313| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148224802|ref|NP_001085313|
Domain Number 1 Region: 15-106
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-16
Family V set domains (antibody variable domain-like) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148224802|ref|NP_001085313|
Sequence length 119
Comment TCR VDJ BV7 BJ7 [Xenopus laevis]
Sequence
mgvlalpcqsnmesvfqehklivvpaggpvdlyckhnhsnsmamlwyqqktgqglklmvy
ssgpnsgemeexfqswtlnrpdiftfnlslkvagssdsaeyfclpggttrdniletgqs
Download sequence
Identical sequences gi|148224802|ref|NP_001085313| gi|1839141|gb|AAC03374| NP_001085313.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]