SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148226336|ref|NP_001088593| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148226336|ref|NP_001088593|
Domain Number 1 Region: 29-127
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-16
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 2 Region: 102-212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000101
Family C2 set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148226336|ref|NP_001088593|
Sequence length 230
Comment hypothetical protein LOC495478 [Xenopus laevis]
Sequence
MNQFYQFYFLWIVLVASQGGHVESVDNYLYGTVELPCEFPFVTGPQDLVMTWLKVVQDSE
NVVVHSYRDGQDITEHQDSRYKGRTRRSRGKLNLILTNVTFDDEGTYICQAANQKSRGSK
EVRLSITSINAEDPTVSMVYTDGGDQLKCWSSGNYRNPQVEWHDREKKDLSGYGKLNITD
IGNGRKMVESVLEYNIEPQQHYFCHVKEGRLKRSARAVVSDETVSVNDEL
Download sequence
Identical sequences Q5U4K4
NP_001088593.1.7800 gi|148226336|ref|NP_001088593| gi|54648223|gb|AAH85061|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]