SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148226622|ref|NP_001081896| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148226622|ref|NP_001081896|
Domain Number 1 Region: 44-295
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.9e-79
Family Eukaryotic proteases 0.00039
Further Details:      
 
Domain Number 2 Region: 568-820
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-71
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 3 Region: 428-541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-31
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 350-419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000353
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 5 Region: 879-986
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000942
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148226622|ref|NP_001081896|
Sequence length 1004
Comment ovochymase-2 precursor [Xenopus laevis]
Sequence
MPTRNLLLGSILLSLAVKGDPGPHRGARCGVSPLGSATELNYLSRIVGGRESKKGQHPWT
VSLKRNGKHFCGGTLVSHCHVLTAAHCLLDRNVKLYMRVYIGEYDQILKEETEQMFRVIE
IFKHPNFNQSQPMNYDVAVLLLDGSVTFDENIQPACLPNPDDVFEPGDLCVTLGWGHLTE
NGILPVVLQEVYLPIVDLSSCLHVMSALKGTVVSSYIVCAGFPEGGKDACQGDSGGPLLC
QRRHGSWVLHGLTSWGMGCGRSWKNNVFLPHNRKGSPGIFTDIQKLLGWVSSQLNTAVPN
KNQESCSMQDGVLSGKSGELIFLKNPMSVTRTMSGAPGFSLSLKTCTSCLNFTHLDIESD
FACNLDYLAIYTDSHRLIGKFCGDIPPRSLLISFSSIKLNFFSDFHENRTGFVLYYSAVE
PNTYPDSGCGSFAVLFEEGEIQSMNYPENYLSNSRCHWIIHGPSGSYIKLQFEDFALEPS
DDCRSDYLAVYQDLAAEDKIETFCGFSLPAPVYSTTAVMHIKFSTDERDNDKGFRATFTF
VSPNSLVEDSRQGNMPSTNKKETTAQDSICGVSQVPPIFIYNSIAKVEEAVPHSWPWHTS
LQYAGEHVCDGAIIAENWILTTASCVLNRKFNDVWLVDPGIHDLLRPGHNQKGLVKQIIP
HPSFSSQTNDFDIALVELDESLQFNSDIFPICLPGKTSELAPASLCVVSGWSLRGKEAEK
STKLQQREVPILTDDACSAHYIQNPGGITDRMLCAGIGTGQDNDSCSEQSGSPLVCLLEK
KGIYTIFGIASWGVNCKENSKPGIYTKVSPFIDWIRQIMSDTGQIHSNLGDPKPHPMGNI
EPEETAGRDIIQGGFPTNDASSNQNLYIASSCEDVVLLQSPGEIKMETKSQMYPNGFSCQ
WRIIAPKFQIIKLVMKQVHMSAENGKCCNSLIIYEGISKNKTLKVRFPTDEMVPGTVWSE
GSSVTIESPPHPVDPEFGFCLVYSFHSRTQSQDHVVPDSDSSEP
Download sequence
Identical sequences P79953
gi|148226622|ref|NP_001081896| gi|1754714|gb|AAB53972| gi|82228350|sp|P79953| NP_001081896.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]