SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148228853|ref|NP_001081066| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148228853|ref|NP_001081066|
Domain Number 1 Region: 590-844
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-88
Family Eukaryotic proteases 0.000000703
Further Details:      
 
Domain Number 2 Region: 328-434
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 202-320
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-23
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 4 Region: 73-185
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000759
Family SEA domain 0.0069
Further Details:      
 
Domain Number 5 Region: 435-476
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 511-548
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 474-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 552-589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148228853|ref|NP_001081066|
Sequence length 845
Comment matriptase a [Xenopus laevis]
Sequence
MKDSDSMMKYNNRPQSLNGFEEGVEFLPATNSKKVEKTGPKKKLAIFGLVIGAALLSLTI
GLLVWHFAYRNKPVNKLYTGYLTIANTPFIDAYENSTTAEFSDLSAKVIDTLQTVYNGNK
DIAPYLQKCSISAFSEGGGNNVIGYYWSEFSVPAFREAAFEKAISELKLPSVNPRQRTFA
LDSLVAYPTDPQIARVFKNSSCAYFLHSSNGVVAKFSSPGFPDSPYPRNARCLWTLRADA
GRIIHLHFKTFKMEKCKPNGGDFVMVYDSLSPIEPRAQIRLCGIYPPSYNLTFFSSSNVM
LVTLVTDNVGKFPGFLAEFKQLPKTSLCGGLIRDASGFITSPYFPAHYPPSTECIWDIQV
PDNKFVKVRFNMFYLAEPGVPVTKCTKDFVEIKGQKYCGEKEFFVVSNNSSKMSVRFVSD
QSYTDTGFTAEYLSYEPRNPCPDQFTCRSGRCIRLDQKCDGWNDCEDFSDEMSCTCTALQ
FRCVNSKLCKPSYFICDGVNDCGDSSDELACKCPNNTFKCGNGKCIPDSQKCDRVDNCGD
GSDEAECDQVLTTACTEYTYKCKNNQCITKKNPECDGENDCSDGSDENAAKCNCGKRPFT
KKSRIVGGVNADTGEFPWQVSLHAKGNKHTCGASLVSPTMLISAAHCFQDDHQMRYSDAS
LWTAYLGLHDQAQLNTKDVVERKIKRIMAHIGFNDNTYDNDIAVLELEKPVEYTDFIQPV
CIPESTHDFPVGKPIWVTGWGALKEGGGAAVILQKAEIRIINQTECNKLLDGQLTPRMLC
AGFVSGGIDACQGDSGGPLSSVELNNKVYLAGVVSWGEGCARRNKPGVYTKVSMMRDWIK
DKTGL
Download sequence
Identical sequences Q6GR54
NP_001081066.1.7800 gi|148228853|ref|NP_001081066| gi|49257232|gb|AAH71077|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]