SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148229240|ref|NP_001081332| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148229240|ref|NP_001081332|
Domain Number 1 Region: 90-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000466
Family Thioltransferase 0.084
Further Details:      
 
Weak hits

Sequence:  gi|148229240|ref|NP_001081332|
Domain Number - Region: 203-261
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0471
Family Recombination protein RecR 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148229240|ref|NP_001081332|
Sequence length 271
Comment type III iodothyronine deiodinase [Xenopus laevis]
Sequence
MLHCAGPHTGKLVKQVAACCLLLPRFLLTGLMLWLLDFQCIRRRVLLTAREESTAEHEDP
PLCVSDSNRMCTVESLRAVWHGQKLDYFKSAHLGCSAPNTEVVMLEGRRLCKILDFSQGK
RPLVVNFGSCTUPPFMARLQAYRRLAAQHVGIADFLLVYIEEAHPSDGWLSTDASYQIPQ
HQCLQDRLAAAQLMLQGAPGCRVVVDTMDNSSNAAYGAYFERLYIVLEGKVVYQGGRGPE
GYKISELRMWLEQYQQGLMGTKGSGQVVIQV
Download sequence
Identical sequences P49899
NP_001081332.1.7800 gi|14717810|gb|AAA49971| gi|148229240|ref|NP_001081332| gi|182702121|sp|P49899|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]