SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148229330|ref|NP_001082352| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148229330|ref|NP_001082352|
Domain Number 1 Region: 13-123
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-28
Family Kringle modules 0.0007
Further Details:      
 
Domain Number 2 Region: 210-315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-23
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148229330|ref|NP_001082352|
Sequence length 421
Comment kringle containing transmembrane protein 2 [Xenopus laevis]
Sequence
MLVEMLWLLLLDIVLYVRSEVAHPELSECFTVNGRDYRGTVSQAGPEGTPCLYWNQTTQH
LYNAQSDPDGELGLGNHNYCRNPDADVQPWCYVSENEEGIYWKYCDIPSCHMPGYLGCFL
DFGTPPALSGASGTSSKLTVQACIRYCRTKGYQYAGVEAGYACFCGDPSDVGTLQPTSSS
QCDQYCFGKPNEICGGDGKISVYSAWVGACHENLTSCSGVLYSPDFPEEYGPGVSCIWDI
LSPGSTAVELQFHIFQIPDPKDILEVRDGASGTLLMKIQGGQKPPSSVTLPTGHLWFHFQ
SDKEFGGPGYAITYRGLPNKLTNSTPTKETSHELYLVSTNSTFEHYSTEHAASSKALLFL
AAALVLLAVCIGIIIWRYPSWCSKNPCAMVQPTTCSMLYRHKKERMGDLTCVNQSSMKSL
L
Download sequence
Identical sequences Q8AXX3
gi|148229330|ref|NP_001082352| gi|213623854|gb|AAI70312| gi|24954094|gb|AAN64661| NP_001082352.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]