SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148230390|ref|NP_001086244| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148230390|ref|NP_001086244|
Domain Number 1 Region: 30-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000185
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 
Domain Number 2 Region: 341-432
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000654
Family I set domains 0.012
Further Details:      
 
Weak hits

Sequence:  gi|148230390|ref|NP_001086244|
Domain Number - Region: 271-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000972
Family C1 set domains (antibody constant domain-like) 0.036
Further Details:      
 
Domain Number - Region: 150-187
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00262
Family I set domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148230390|ref|NP_001086244|
Sequence length 462
Comment immunoglobin superfamily, member 21 [Xenopus laevis]
Sequence
MIWPGVGALLLPLLPLALGYLTVTIEPLPPVVVGDAVTLKCNFKTDGRMREIVWYRVTDG
GTIRQKIFTFDAMFSTNFSHMENYRKREDLLYQSTIRLPEVRISDNGPYECHVGIYDRAT
REKVVLSSDNVFLNVMSPPVSIAVLAADSPAPFSRYQAQNFTVVCIVSGGKPAPQVSFKR
DGELIDVVPMLEPPPAAAGLLGNHPSRNLFNRDSDDTKMQKTLSLLDTEERGLSPFTENP
YRVRAADQGPMSSPVTEAIPETVVSLEFPRWVHSTDPAYFFHQMHLPMSDGTVEVRAMLT
WTLNSQVDNEALFSCEVKHPALSMPMQSEVTLAAPKGPKIMMSPTRARVGDTVRITVHGF
QNEVFPEPLFTWTRVGGRLLDGRAEHDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHT
RLIIFENPNIPRGTEDSNSSGSLDSNRLTSVLLILTVIYELT
Download sequence
Identical sequences Q6GLT3
gi|148230390|ref|NP_001086244| gi|49257868|gb|AAH74370|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]