SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148230941|ref|NP_001083744| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148230941|ref|NP_001083744|
Domain Number 1 Region: 117-310
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.81e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 737-845
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-37
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 432-536
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-37
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 4 Region: 582-692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-35
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 5 Region: 313-424
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-34
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 6 Region: 874-966
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-29
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 7 Region: 693-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000321
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 537-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000437
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148230941|ref|NP_001083744|
Sequence length 977
Comment bone morphogenetic protein 1 [Xenopus laevis]
Sequence
MPWLGSLPLLLCWALLAGMLHLGQGQVFMDYSYDLEEVVEETIDYKDPCKAAAFWGDIAL
DEEVLANFKIDRIVDLTKHTIHTVSGAATNISRPEKGRRTRKERRRSREKRASTSRPERV
WPDGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYV
GRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDNVSIIRENIQPGQEYNF
LKMEPEEVESLGETYDFDSIMHYARNTFSRGIFLDTILPKYDVNGVRPPIGQRTRLSSGD
VAQARKLYKCPACGETLQDSQGNFSSPGFPNGYSAYMHCVWRLSVTPGEKIILNFTSLDL
YRSRLCWYDYIEVRDGFWKKAPLRGRFCGDKIPESIISTESRLWIEFRSSSNWVGKGFQA
VYEALCGGEVKKDSGHIQSPNYPDDYRPNKACVWKLSVSEGFHVGISFQSFEIERHDSCA
YDYLEIRDGSSETSPLVGRFCGYDKPDDIKSSTNQLWIKFVSDGSINKAGFSLNYFKEVD
ECSRPNNGGCEQRCVNTLGSYKCACDPGYELGQDKKSCEAACGGFLTKLNGSINSPGWPK
EYPPNKNCIWQLVAPTQYRISLKFDQFETEGNDVCKYDFVEVRSGLTSDSKLHGKFCGSE
LPAVITSQYNNMRIEFKSDNTVSKKGFQANFFSDKDECSQDNGGCQHECTNTLGSYICQC
RSGFTLHENKHDCKEAGCDHKMTTSTGTISSPNWPDKYPSKKICTWQITATPGHRVKLTV
SEVDLESHQECLYDHVEVYTGRNAQSPVLTRFCGSKIPDPIISPGNTMFLKFMSDNSVQK
RGFLGELSSVCGGTLHAEVRTQDLYSHAKLGDDTHPSGTECLWHIVSEAGYGVELVFQSF
ELEEEPDCGYDYMELYDGPDEAAPRLGRFCGSGPPEEVYSAGDALTIKFHSDDTINKKGF
HVRYTSTKFQDTLHARK
Download sequence
Identical sequences Q91925
NP_001083744.1.7800 gi|1209014|gb|BAA11922| gi|148230941|ref|NP_001083744|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]