SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148231736|ref|NP_001080227| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148231736|ref|NP_001080227|
Domain Number 1 Region: 251-369
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.08e-55
Family Calsequestrin 0.00000109
Further Details:      
 
Domain Number 2 Region: 149-250
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-25
Family Calsequestrin 0.0000322
Further Details:      
 
Domain Number 3 Region: 27-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.61e-22
Family Calsequestrin 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148231736|ref|NP_001080227|
Sequence length 428
Comment calsequestrin 1 (fast-twitch, skeletal muscle) [Xenopus laevis]
Sequence
MKGPWLVLAALCLALANLGAWAEDGLDFPEYDGEDRVININLKNYKAALKKYEVLALLYH
EPIEDDKASQRQFEMEELIFELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLDEEDSIYVF
KDDEVIEYDGEFAADTLVEFLLDVLEDPVEFIEGSHELAAFENIDEDQKLIGYFKNEDSD
HYKAYLDAAEEFHPYIPFFATFDSKVAKKLDLKINEIDYYEPFHDEPVTIPNKPNSEEEI
VDFLHLHKRPTLRKLKPDSMYETWEDDLDGIHIVAFAEEDDPDGYEFLEIIKEVAEDNTD
NPDLSIIWIDPEEFPLLIPYWEETFNIDLSRPHIGIVNVTDADSIWMDMDDEEDLPTVDE
LEDWLEDVLEGDVNTEDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DDDDDDDE
Download sequence
Identical sequences Q7ZWM0
NP_001080227.1.7800 gi|148231736|ref|NP_001080227| gi|28422215|gb|AAH46947|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]