SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148232692|ref|NP_001085522| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148232692|ref|NP_001085522|
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.7e-33
Family Thioltransferase 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148232692|ref|NP_001085522|
Sequence length 105
Comment MGC80314 protein [Xenopus laevis]
Sequence
MVRHIENLEEFQLVLKEAGGKLVVVDFTATWCGPCKMIAPVFEKLSVDNPDAVFLKVDVD
DAQDVAAHCDVKCMPTFQFYKNGIKVDEFSGANQSSLIQKVEALK
Download sequence
Identical sequences Q6GQ64
NP_001085522.1.7800 gi|148232692|ref|NP_001085522| gi|49119156|gb|AAH72884|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]