SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148233474|ref|NP_001088947| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148233474|ref|NP_001088947|
Domain Number 1 Region: 123-228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 54-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000397
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148233474|ref|NP_001088947|
Sequence length 292
Comment hypothetical protein LOC496324 [Xenopus laevis]
Sequence
MACSDHSPLSAILFLGLLLGYCGLFPGPAYAQNEPKISATEEITIKKETSATPIFLHCNI
TVTSSQGGLERGFWTKNGLEIQDTSKTSFPEPALELKITKPKADDSGEYMCVFIFKNNSP
PANATIEVKAVPEISSHKKSENKNEGQEAVLFCKCVGYPPPDWTWYKVTDGGLAELNNGS
GRMFITSKDNYTELKIINLDITNDPGTYLCNASNTIGSDNTTTILRVRSNLAPLWPFLGI
VAEIVILAVVIVVYEKRRRPDEVPDDDEPAGPMKSNSTNNHKDKNLRQRNTN
Download sequence
Identical sequences Q5HZR6
NP_001088947.1.7800 gi|148233474|ref|NP_001088947| gi|57032690|gb|AAH88914|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]