SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148235291|ref|NP_001088585| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148235291|ref|NP_001088585|
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.36e-38
Family MHC antigen-recognition domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 125-211
Classification Level Classification E-value
Superfamily Immunoglobulin 3.98e-24
Family C1 set domains (antibody constant domain-like) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148235291|ref|NP_001088585|
Sequence length 262
Comment hypothetical protein LOC495464 [Xenopus laevis]
Sequence
MSGVSVRVVSVLLTLSVCLSSSPPEDYVVQAKSQCYYRNGTDNVRYLQRYIYNQEECVYF
DSDVGLFIAKTELGKVHFADYWNSQKEILEQKRAEVDTICRNNYQIFKPTAIDRKSQPNV
KIVNTKTLDLEHENLITCLVDGFFPSMIKVTWLKNGIEEGEQVTSSELLQNGDWTFEIHV
MLETTIKHGDTFTCRVEHSSLQQPVSVNWEPDVSDSARNKMLTGIVGFVLGSIFIIVGLV
VYLRSKKTMTRFSMVQNENLMS
Download sequence
Identical sequences Q5U4M9
gi|148235291|ref|NP_001088585| gi|54648185|gb|AAH85029| NP_001088585.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]