SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148235697|ref|NP_001088112| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148235697|ref|NP_001088112|
Domain Number 1 Region: 75-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.09e-55
Family Astacin 0.0000264
Further Details:      
 
Domain Number 2 Region: 382-496
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-34
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 272-381
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-30
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148235697|ref|NP_001088112|
Sequence length 499
Comment hypothetical protein LOC494813 [Xenopus laevis]
Sequence
METALYLILLFCLLGPSLTLPLLDTSLKANIKDDEHPGDNNIFSNIMKANQGSRRLRKQG
DIAIKTRRNAIDCPECLWPKSSDGIVYVPYTVSSQYSDDEVSVITKAMEEYNGLTCLQFT
PRTNEDNYVSIQSLDGCWSFIGLYGGSQAVSLMKGFCVYNGAVQHELTHALGFYHEQCRS
DRDDYVTIMYQYISPEDKVNFDKADTNNLGVVYDYSSIMHYGSNAFSNTSGENTIVPHPN
PNVTLGQSYGLSNLDVLKINRLYGCDVCSTLLSASNGTLTSVNYPSNYQNNANCVWLIRT
PSDQVTLKFDAFKVQQSTGCIKDYIRVYDGATRSAPMILDKTCGTGRVPVMIASTNHMLV
EFVTDNAITATGFKASYSTVKCGGTFYTPSRNITTPNYPNSYPPNLDCQFLITAPPFYKV
ALNISDFFLEMSSTCKYDYLEIYNGDSMNAPKMGSSKYCGYQIFNVMVSDGRSMLLRFYS
DDAVQMYGFKASYTFVPSV
Download sequence
Identical sequences Q63ZG3
gi|148235697|ref|NP_001088112| gi|52354695|gb|AAH82956| NP_001088112.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]