SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148236225|ref|NP_001089377| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148236225|ref|NP_001089377|
Domain Number 1 Region: 134-228
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.13e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148236225|ref|NP_001089377|
Sequence length 263
Comment hypothetical protein LOC734427 [Xenopus laevis]
Sequence
MSTSIPSVELFVRAAPSNKKEKGSCLVGQQWMMVLRDLELKGLITLQVTPTSMDNPPENY
TKLNAARLLPIAWIQSGELDGEDARGMVISSSGSLETLMVKLKVPNLNASLKKEDVLHAE
KVCEDLYKNFMNYVRNNMSRPLLTTLSNLDTYLASQKGVYLLGDDLSYVDCQLMPRLQHI
RVAGRAYKKFDIPDDLCHLWQYIKQMYTTDSFTYSCPCDRDILMHYEERDPLPKDIRPCL
LGSGCLCDIPSTVVLARANGDTD
Download sequence
Identical sequences Q566G0
gi|148236225|ref|NP_001089377| gi|62471481|gb|AAH93565|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]