SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148236357|ref|NP_001079120| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148236357|ref|NP_001079120|
Domain Number 1 Region: 428-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-71
Family Eukaryotic proteases 0.00000818
Further Details:      
 
Domain Number 2 Region: 18-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00000914
Further Details:      
 
Domain Number 3 Region: 189-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-25
Family Spermadhesin, CUB domain 0.0000459
Further Details:      
 
Domain Number 4 Region: 301-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000862
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 367-438
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000011
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 6 Region: 138-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148236357|ref|NP_001079120|
Sequence length 688
Comment mannan-binding lectin serine peptidase 2 [Xenopus laevis]
Sequence
MTEFRLLASLLIWAVAFPCDGTSTELTALFGRISSPGFPKPYSNDLTMNWNIKVPEGYRI
KIYFTYFNLELSYLCEYDYLKLSSKGTEVAHFCGKESTDTEKAPGDSVFYSLDNKMTVTF
RSDYSNEMEFTGFDAFYSAEDINECKETPESCDHFCHNHLGGFYCTCRAGFTLHSDKKIC
QAKCPDAVYKRSSGTITSPDYPDAYPKLFNCKYRILVEEGLYIILKFLHFNVEFHQDVPC
PYDKLQLQITAKGKEIALLCGETIPTDIEIRSNEAEVFFSTDDSGYHTGWKIQYTTKAIP
CPDPILTNKGHFTPQQKTYVARDRLSLTCDKGFVLLEDSRTIPSFTMTCQPNGTWDKKLP
KCIIVNCGNPDDIDNGKYTFVTAKEVTLYNSVVQYECTGPFYYMKDGKGKYRCGADGFWG
DIESEKTTPPVCAPDCGMKKAVARARIVGAQVASIGEFPWQVYLNVNNEKGGGALLLDNW
ILTAAHVVYSYKDLSTILIKMGFLTTQDSDYIRSWPEAVFIHEGYKQGSYDNDIALIKLK
DKVPLSESVLGICLPTREKRYHISQNEGDNHVGLVSGWGLTDRNVPSRKLRFVEVNIVDH
STCKLNMQPRCTIFSYRNMICAGFETGGKDSCAGDSGGALAFMDIESKKWFVGGIVSWGV
DCGVARQYGVYTKVTNYYDWIQKTIQSN
Download sequence
Identical sequences Q9PVY4
NP_001079120.1.7800 gi|148236357|ref|NP_001079120| gi|6407531|gb|BAA86865|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]