SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148237476|ref|NP_001079667| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148237476|ref|NP_001079667|
Domain Number 1 Region: 56-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000107
Family Thioltransferase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148237476|ref|NP_001079667|
Sequence length 183
Comment anterior gradient protein 1 precursor [Xenopus laevis]
Sequence
MQAGLSLVCLVLLCSALGEAVLKKPKKQAGTTDTKTDQEPAPIKTKGLKTLDRGWGESIE
WVQTYEEGLAKARENNKPLMVIHHLEDCPYSIALKKAFVADRMAQKLAQEDFIMLNLVHP
VADENQSPDGHYVPRVIFIDPSLTVRSDLKGRYGNKMYAYDADDIPELITNMKKAKSFLK
TEL
Download sequence
Identical sequences A0A1L8EWK3 P55868
NP_001079667.1.7800 gi|148237476|ref|NP_001079667| gi|1667601|gb|AAB18819| gi|2499133|sp|P55868| gi|28422349|gb|AAH46838|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]