SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148237880|ref|NP_001080560| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148237880|ref|NP_001080560|
Domain Number 1 Region: 135-232
Classification Level Classification E-value
Superfamily Fibronectin type III 5.27e-24
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 230-328
Classification Level Classification E-value
Superfamily Fibronectin type III 4.29e-20
Family Fibronectin type III 0.00000233
Further Details:      
 
Domain Number 3 Region: 59-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000037
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148237880|ref|NP_001080560|
Sequence length 396
Comment ciliary neurotrophic factor receptor [Xenopus laevis]
Sequence
MANPVTSACCVILAAMMMMMVSAQRRGQEVKPKSRPLLTDYLFQERLQSQRAGRSSQREP
HIQYEQTGSDAILRCGTVDQDAAVTWTVNGTDIENPHLNGSSLLLHNVNLSHSGYYSCFE
GSSWKLWHQTNLRVGNPPREPVLMCRSNNYPASFYCSWHLPFPTFIPNTFNITVIHDSKQ
LYCEKDPFPKNRCHIKYSRLFSTQKYQVTVVVTNALGKNSTSISFDEFSIVKPDPPENVV
AKPVHNNPRRLEVTWQIPSTWPDADSFPLKFFLRYRPLILDQWQHVELSEGTSHTITDAY
AGKEYIIQVAAKDYEIGTWSDWSVATYATPWTEEPKYITTESQKTETTTRITTTTTTTYV
VPPSTKVCEPESVIGSTVRLSWLPALLLAPVGILIM
Download sequence
Identical sequences A0A1L8I2Z4
gi|148237880|ref|NP_001080560| gi|27694836|gb|AAH43961| XP_018122828.1.7800 XP_018122836.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]