SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148745597|gb|AAI42555| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148745597|gb|AAI42555|
Domain Number 1 Region: 74-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.71e-48
Family Astacin 0.0000822
Further Details:      
 
Domain Number 2 Region: 381-493
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-35
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 272-381
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148745597|gb|AAI42555|
Sequence length 502
Comment LOC100101287 protein [Xenopus laevis]
Sequence
MDSAASILLLLPWLLKLALTLPIEVIFPEPAANETNVVHGDDVFGDILRANEGSKVLLRE
TDIAVAPGRNAISCKTCLWPKSASGRVYVPYAFDDKYSEGEKATMREAIKDFGTMTCVEF
VPLTAENNYLSIHPGDGCWSFMGVMGGAQGVSLGGGCLGYRTIQHELMHALGFWHEQNRS
DRNKYIDVFWQYISPDAYINYQEMDTNNLGMEYDYLSAMHYETWMFSNTSGKTTMAAKDD
PNRRLGGAKELTNLDYSKINRLYECDVVSTLLNEDRGTLKSANYPSSYPNNAKEFFLIRT
VSQQVSLKFEAFDIQSSPQCTSDYIKIYDGSTKSSPVLLEKSCGMGKHPPLIASGRAMLL
EFISDGSQTATGFRASYETVECGGTFTTPSRNITSPNHPKDYPPSKTCQYIITAPLSYKI
SLRLISMDIERSRQCRRDYLDIYDGDSIDAPLLGRFCGSLMMCSPRSNGNRMLLRFVTNA
NIQGKGFLLRYSWVAPRGSVLP
Download sequence
Identical sequences A5PKN4
NP_001093347.1.7800 gi|148745597|gb|AAI42555| gi|153791998|ref|NP_001093347|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]