SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148886694|ref|NP_001092157| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148886694|ref|NP_001092157|
Domain Number 1 Region: 26-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148886694|ref|NP_001092157|
Sequence length 173
Comment mitochondrial ribosomal protein S25 [Xenopus laevis]
Sequence
MPMKGRFPIRRTLQYLQAGEIVFKNNVKIMTVNYNTHGEHGEGARKFVFFNIPQIQYQNP
WVQIMMFKNMTPSPFLRFYLDSGEQVLVDIDDKSNTEISQHVKKILGKKEETLKAEEQAK
MVKSNPANFGLRKYHLRECICEVEGQVPCPSKIPLPKEMTGKYKAQQKERTEE
Download sequence
Identical sequences A5D8M3
gi|146327086|gb|AAI41733| gi|148886694|ref|NP_001092157| NP_001092157.1.7800 XP_018111823.1.7800 XP_018111824.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]