SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159155473|gb|AAI54979| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159155473|gb|AAI54979|
Domain Number 1 Region: 142-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-30
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 2 Region: 29-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000654
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159155473|gb|AAI54979|
Sequence length 588
Comment LOC100127260 protein [Xenopus laevis]
Sequence
MPSLEWLTIFFVLLAPSLAQEKASPISEQCGDVLTEPYQPLQIKQSADKDCTWDIKRSAN
ETTRLVFSVLNLNPNADCSQENVTVSDENLQVLGVLCPNSPQISVFEAVGGLSVRVFTDS
NTSDRILYLFYNSFATGSEPVSCGGNTRGISGTISSPSYPNRHPDFAFCVWHLDAPKNTK
IQLSFTEIFLEIDPLCRFDFIAVYDGPSTSSPLLDLLCGRTTAQLETSSNSVTLMLSADY
ANSYFGFSAAYKALPKSNTTSLSCSGDEMTVIINPSYLESLGYTADELTLTDTACGPLSS
NPVAFIVPYQTCGTVRKLEDHTISYTNTISASLARGLITRRKQVQIIVTCELDGNTVVEI
MYTTEDDIIQEQRDTSRYDVGLSFFTSETFVTPVLESPYFVDLNQTLFLQATLHLPDPQL
TVFTDSCFASSEPKFQAATYDLVRQGCAKDDTYHNFPSGSGFARFSFGAFKFLHLHNSVY
LKCRVVICDTNDTASRCNQGCITRHRRDLGSSKWKANAVVGPIRLGHHTHNDISESIGEE
NGSKAEHGSFYLFGILVLVANVLIVSLVVLRSSRKQRAAYRYHPVPTQ
Download sequence
Identical sequences A8WH54
NP_001106309.1.7800 gi|159155473|gb|AAI54979| gi|163914449|ref|NP_001106309|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]