SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163916115|gb|AAI57432| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163916115|gb|AAI57432|
Domain Number 1 Region: 84-276
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.11e-53
Family Astacin 0.0000484
Further Details:      
 
Domain Number 2 Region: 348-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-29
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163916115|gb|AAI57432|
Sequence length 459
Comment LOC100137635 protein [Xenopus laevis]
Sequence
MHLVLLLVALCSSCLAFPTKNPDVIQTEPTERKQTATAGEEKKSVFERLHEVNKHTPTLT
GKYIISQLDIASSVSRSFNFCPQGICLWPISSDGLVRIPYVISADYTPYEQALFEASFKD
FADETCIRLVPRTSETNYLSFESLNGCWSPIGRVGGAQTVSLQRSGCMWASVIEHEIMHS
LGLHHEHVRNDRDKYVSVQWNNISPGYQGNFQMTSTNNMILTKYDYESLMHYSRTAFSID
GFLPTLVAVPDPNIPLGNGYMMSDLDIMKLNTLYKCAQPKPNQISQEEIKVQDKPSLTTM
ARPTTTTPTATTSTPKTTITTTTTNPTTTTTITTNTNTNLNALLSNVCGGTLSGPSGVIT
SPNYPNNYPKNAYCHWNITTTSQFTITFTGMDVEDIPYCIWDSVKVYNGPIINNAFLIGT
YCGKNLPSPITFYNMSVQIVFASDAIVERKGFSLEYHTV
Download sequence
Identical sequences A9ULX0
NP_001108257.1.7800 gi|163916115|gb|AAI57432| gi|168693481|ref|NP_001108257|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]