SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169642040|gb|AAI60781| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169642040|gb|AAI60781|
Domain Number 1 Region: 21-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.04e-26
Family PDI-like 0.045
Further Details:      
 
Weak hits

Sequence:  gi|169642040|gb|AAI60781|
Domain Number - Region: 152-239
Classification Level Classification E-value
Superfamily PIN domain-like 0.0961
Family 5' to 3' exonuclease catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169642040|gb|AAI60781|
Sequence length 264
Comment LOC100158326 protein [Xenopus laevis]
Sequence
MAPLLFFSLGLILCSSEVMAKKGDVIEITDSNWNDVLEGEWMIKFYAPWCPACHNLQPEW
NEFADWGEDLNVNIAKVDVTAQPGLSGRFIITALPTIYHCKDGVFRKYQGSRSHKDFINF
ISEKEWETIEPVSSWAGPSSFLMSGMSALFQLSMWIRQCHNYFVEDLSIPVWGSYIIFGL
MTLFLGLFLGLILVFVADFLCPSKRHRPQEYQYIKNLPTEPADRKKLEDEEKEEEVNDFE
NGKLEDKEASDVPQDKLRKRTAKS
Download sequence
Identical sequences B1H1Y3
NP_001121246.1.7800 XP_018084032.1.7800 XP_018084033.1.7800 gi|169642040|gb|AAI60781| gi|189217578|ref|NP_001121246|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]