SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|1731806|gb|BAA14003| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|1731806|gb|BAA14003|
Domain Number 1 Region: 95-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-54
Family Astacin 0.0000535
Further Details:      
 
Domain Number 2 Region: 401-513
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-35
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 295-400
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-30
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|1731806|gb|BAA14003|
Sequence length 514
Comment hatching enzyme [Xenopus laevis]
Sequence
MDVKISAILLACIIQYAVSSPIQVFYSGAKILAEEDAMAKEDILKAIEKADPGSVKTQDS
MDILSQILEANKGIKLQTQEGDIIQKQGRSAINDARFLWPKSADGIVPVPYNLSYSYNAD
QLALFKKAIQEFEALTCVRFVPWTTEVNFLNIMSNGGCGSLIGKNGGAQRLELDANGCMN
MGIIQHELNHALGFYHEQNRSDRDDYVIIHTENIIPDFLKMFEKYNTNNLGIEYDYASVM
HYSRYHYSINGDITIEPKPDPNVPIGQRDGLSILDISKINKLYECNVCSNLLPYSNGMMI
SANYPSAYPNNANCVWLIRTPSGQVTLQFQAFDIQSSSGCVSDYIKIYDGPTKAFPVLVN
RACGTGLIPLQIASTNQMLVEFVSDRAVTGTGFKATYGSIQCGGAFYSSPKTFTSPNYPG
NYTTNTNCTWTITAPAGFKVSLRITDFELEIGASCRYDYLNIYNSTLGAVMGPYCGPIDF
HSAIVSKSNSMMITMNSDFSKQYKGFSATYTFVR
Download sequence
Identical sequences B7ZQ15 P42664
gi|147901179|ref|NP_001081221| gi|1731806|gb|BAA14003| gi|213625022|gb|AAI69646| gi|213626588|gb|AAI69674| gi|2828509|sp|P42664| NP_001081221.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]