SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18652934|gb|BAB84702| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18652934|gb|BAB84702|
Domain Number 1 Region: 149-249
Classification Level Classification E-value
Superfamily Immunoglobulin 2.72e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 35-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000816
Family Growth factor receptor domain 0.0023
Further Details:      
 
Domain Number 3 Region: 103-148
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000347
Family Ovomucoid domain III-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|18652934|gb|BAB84702|
Sequence length 285
Comment Mig30 [Xenopus laevis]
Sequence
MFGSRALLTFFLCLHSIGQARRLPWKGWAKHIEGKCPQCQEERCPPVPQWCPSGRVLDAC
GCCWECANVEGQLCDMAWQGHTFGACGEGLRCQLRGGHHVNEPQCVCNSQESVCGTDRRT
YRNVCRMQEAARTRRRAQLTLAHVGPCKEAPAVLTAPQETVALVGQRVILGCEVTAQPLA
ELEWRKEGTEGALPGKSSHIIVQTRGGPHRTQVTGWLQIHQVREEDVGLYMCHAWNAFGE
VTASAQLKVISADSTQTPEVNGELDVTDDEDAYERSREGPSGSHE
Download sequence
Identical sequences Q8QFQ2
NP_001082206.1.7800 gi|148229565|ref|NP_001082206| gi|18652934|gb|BAB84702|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]