SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|205360866|ref|NP_001128539| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|205360866|ref|NP_001128539|
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.32e-36
Family MHC antigen-recognition domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 124-210
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-23
Family C1 set domains (antibody constant domain-like) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|205360866|ref|NP_001128539|
Sequence length 261
Comment hypothetical protein LOC100189567 [Xenopus laevis]
Sequence
MCGVSVRVVSVLLTLSVCLCSSLPEDYVFQAKCQCYYRNGTDNIRYLEGYANNQEEYAYF
DSDVGEYKAKNDFGEVQAKYWNSQKEILERARAVVDTLCRPNYQLGKPFTVDRKSQPDVK
IVNTKTLDLEHENLITCIVDGFFPPMIKVTWLKNGIEEGEQVTSSALLKNGDWTFEIHVM
LETTIKHGDTFTCQVEHSSLQQPVSVNWEPDVSESARNKMLTGIVGFVLGSIFIIVGLVV
YLRSKKTMTRFSVVQNENLMS
Download sequence
Identical sequences A1A616
gi|118835432|gb|AAI28914| gi|205360866|ref|NP_001128539|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]