SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213623786|gb|AAI70221| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213623786|gb|AAI70221|
Domain Number 1 Region: 406-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-76
Family Eukaryotic proteases 0.0000937
Further Details:      
 
Domain Number 2 Region: 22-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.0000213
Further Details:      
 
Domain Number 3 Region: 182-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.0000132
Further Details:      
 
Domain Number 4 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 5 Region: 133-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000958
Family EGF-type module 0.0017
Further Details:      
 
Domain Number 6 Region: 362-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000967
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213623786|gb|AAI70221|
Sequence length 717
Comment Mannose-binding lectin-associated serine protease-3b [Xenopus laevis]
Sequence
MRIPLLFSICLWMLSEAEVIQLTDMFGEIRTPNFPDSYPSESGVTWNITVPEGFRLKLYF
MHFDLEPSYLCEYDYAKVETEDQVIATFCGKESTDKEQAPGQRIITSPGNFLSLTFRSDF
SNEERFTGFDAHYSAKDIDECTEKSDEDLVCDHHCHNYIGGFYCFCRFGYLLHTDNRTCK
VECSDNLFTQRSGFISSPDYPSPYPKSSNCRYRIELEEGFVINLHFDDSFDVEDHPQVTC
PYDFVKIKSGKKEFGPLCGEKSPGRIETGSNSVQILFNSDNSGENGGWRLSYSATGAPCP
NLHPPINGKLEPSQSEYIFKDQVVVSCNQGYQVLKNNVEMESFQIECRKDGTWSNQIPPC
QIVDCRTPKEIENGFITYPTADNHTTYQSSFNYSCREPYYIMVPNITSVYTCDSNGEWTS
QEIEAKIPTCQPACGKPTQPLPGIVKRIIGGRNAEPGFFPWQVLIVVEDLSRVPMNKWFG
GGALISDSWVLTAAHNLRSQRRDNTVMPVSKEHVTIYLGLHDVQSKTDSVNRTIEKIILH
EMFDPESYNHDIALVKLNEKVIMNQYVMPVCLPEFEHELEGPQPNTLGLVAGWGISSANI
TVEEVISSDIRTHSAILQYVKLPVVLHAVCKESYESRSGNYSVTENMFCAGYYEGGKDTC
FGDSGGAFIMQDTDTKRWVAQGLVSWGGPEECGSKQVYGVYTKVSNFVDWVDDKLKS
Download sequence
Identical sequences B7ZRM5
gi|213623786|gb|AAI70221| gi|213626839|gb|AAI70219|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]