SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213625193|gb|AAI70040| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213625193|gb|AAI70040|
Domain Number 1 Region: 156-351
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-59
Family Astacin 0.000081
Further Details:      
 
Domain Number 2 Region: 785-889
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-37
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 623-733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 473-576
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-35
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 5 Region: 358-467
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-34
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 6 Region: 914-1007
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-29
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 7 Region: 734-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000154
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 578-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000533
Family EGF-type module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213625193|gb|AAI70040|
Sequence length 1019
Comment Xolloid [Xenopus laevis]
Sequence
MSCGSPQVMMTLWTLTCVGLILLGAIRLSLGLDYDLESFDYLMEDNPEEFDYKDPCKAAA
YWGDIALDEDDLKWIFKNKSNDLRNTRHNQTHPTTDNFSEKLGTGSQNETSSNLNSKKVK
KGSRLKLLIAEKAATETNSTFQVQTSNDRVRRAATSRTERIWPGGIIPYAIAGNFTGTQR
AIFKQAMRHWEKHTCVTFVERTDEESFIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKF
GIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVSSLGETYDFDS
IMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQD
SSGNFSAPGYPSGYPSYTHCIWRISVTPGEKIILNFTTMDLFKSRLCWYDYIEIRDGYWR
KAALLGRLCGDKLPDPIISSDSKLWIEFRSSSNILGKGFFAAYEAICGGDIKKDSGQIQS
PNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGR
FCGYEKPEDIKSTSNKLWIKFASDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLG
SYKCVCEPGFELTADKKSCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYR
ISLQFEVFELEGNDVCKYDYLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRIEFKSD
NTVSKKGFKANFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCE
QKLLNAEGTISSPNWPEKYPSRKECTWDISVTAGHRVKLVFTDFEIEQHQECAYDHLELY
DGPNGKAAILGRFCGSKEPSPVIASTNNMFLRFYSDASVQRKGFQAKYSPECGGRLKAEI
QTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGY
DSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTKFQDALHMRRK
Download sequence
Identical sequences B7ZR47
gi|213623659|gb|AAI70044| gi|213625193|gb|AAI70040|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]