SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|214872|gb|AAA49980| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|214872|gb|AAA49980|
Domain Number 1 Region: 206-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 100-205
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-30
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 1-91
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.14e-23
Family Astacin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|214872|gb|AAA49980|
Sequence length 319
Comment UVS.2 protein [Xenopus laevis]
Sequence
heqnrsdrddyviihteniipdflkmfekyntnnlgieydyasvmhysryhysingditi
epkpdpnvpigqrdglsildiskinklyecnvcsnllpysngmmisanypsaypnnancv
wlirtpsgqvtlqfqafdiqsssgcvsdyikiydgptkafpvlvnracgtgliplqiast
nqmlvefvsdravtgtgfkatygsiqcggafysspktftspnypgnyttntnctwtitap
agfkvslritdfeleigascrydylniynstlgavmgpycgpidfhsaivsksnsmmitm
nsdfskqykgfsatytfvr
Download sequence
Identical sequences gi|214872|gb|AAA49980|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]