SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|2695977|gb|CAA70853| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|2695977|gb|CAA70853|
Domain Number 1 Region: 115-309
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.91e-60
Family Astacin 0.0000825
Further Details:      
 
Domain Number 2 Region: 431-535
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-37
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 581-691
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 4 Region: 312-423
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-35
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 5 Region: 536-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000188
Family EGF-type module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|2695977|gb|CAA70853|
Sequence length 735
Comment bone morphogenetic protein 1b [Xenopus laevis]
Sequence
MPWLGSPPLLLWALLAGMLHLGQGQEFLDYSYDLEEVVEESIDYKDPCKAAAFWGDIALD
EEDLANFKVARIVDLTKHTISTVSGAASNSSRPQRGRRTRKQRRRSRERRAATSRPERVW
PDGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIIFTYRPCGCCSYVG
RRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFL
KMEPEEVESIGETYDFDSIMHYARNTFSRGIFLDTILPKYDVNGVRPPIGQRTRLSSGDI
AQAKKLYRCPACGETLQDSQGNFSSPGFPNGYSAYMHCVWRLSVTPGEKIILNFTSLDLY
RSRLCWYDYIEVRDGFWKKAPLRGRFCGDKIPEPIISTESRLWIEFRSSSNWVGKGFQAV
YEALCGGDVKKDSGHIQSPNYPDDYRPNKACVWKLSVSEGFHVGISFQSFEIERHDSCAY
DYLEIRDGSSESSPLIGRFCGYDKPDDIKSSTNQLWVKFVSDGSINKAGFSLNYFKEVDE
CSRPNNGGCEQRCVNTLGSYKCACDPGYELGPDKKSCEAACGGFLTKLNGSITSPGWPKE
YPPNKNCVWQLVAPTQYRISLKFDQFETEGNDVCKYDFVEVRSGLTSDSKLHGKFCGTEL
PAVITSQYNNMRIEFKSDNTVSKKGFQANFFSEKKNNVQKLQQQNEVNRGQQQNQAPKRG
RPRMRLRTMKKTRPP
Download sequence
Identical sequences O57381
gi|2695977|gb|CAA70853|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]