SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27694942|gb|AAH43636| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27694942|gb|AAH43636|
Domain Number 1 Region: 306-426,477-500
Classification Level Classification E-value
Superfamily TPR-like 5.75e-27
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 
Domain Number 2 Region: 229-344
Classification Level Classification E-value
Superfamily TPR-like 9.17e-24
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Weak hits

Sequence:  gi|27694942|gb|AAH43636|
Domain Number - Region: 119-164
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.0222
Family N-terminal coiled coil domain from apc 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27694942|gb|AAH43636|
Sequence length 652
Comment LOC398473 protein [Xenopus laevis]
Sequence
RTRGLPQEGKPLHLTPSESMSVMMYPREEKLDKLSQEEIISNTKLVMQGLEALRNEHNSI
LHSLLETIKCLKKDEEANLVHEKSSLLRKSVEMIELGLGEAQLMMALSNHLTAVESEKQK
LRAQVRRLCQENQWLRDELANTQQKLQHSEQNVAQLEEEKKHLEFMNQLKKYDEDVSPTE
EKEGDSAKDNLDELFPNEEDDSGQGIPHQHGSAAAAAAQQGGYEIPARLRTLHNLVIQYA
SQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALSI
REKTLGKDHPAVAATLNNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNN
LALLCQNQGKYDEVEYYYCRALEIYQARLGPDDPNVAKTKNNLASCYLKQGKYKAAEQLY
KDILTQAHVKEFGSVDDDHKPIWMHAEEREEMSKTPHNDSTPYSEYGGWYKACRVNSPTV
NTTLRNLGALYRRQGKLEAAETLEECAQRSRRQGLDPANQTKVAQLLKEGDTPEQRRKGR
ETPRSSVKYESGTEGGEEVSMGGVEWSGDGSGMLRRSGSLGKIRDVLRRSSEMLVKKLQG
AAPAEPRSTNMKRAASLNYLNKSSDETFQVSQNLLSETRGLSASNIDLSSHS
Download sequence
Identical sequences Q7ZYM0
gi|27694942|gb|AAH43636|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]