SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27924201|gb|AAH44996| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27924201|gb|AAH44996|
Domain Number 1 Region: 60-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000136
Family Selenoprotein W-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27924201|gb|AAH44996|
Sequence length 139
Comment MGC53056 protein [Xenopus laevis]
Sequence
MQVISQRYPDIRIEGENFLPHPIYRNIASFLSVFKLVLIGLIIAGKDPFALFGMQAPSVW
QWGQENKVYACMMVFFVSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSVQQLVQIID
NEMKLNVHMDAVPHHHHRS
Download sequence
Identical sequences Q7ZXH0
NP_001079587.1.7800 gi|147902018|ref|NP_001079587| gi|27924201|gb|AAH44996|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]