SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28422198|gb|AAH46850| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28422198|gb|AAH46850|
Domain Number 1 Region: 291-410,459-482
Classification Level Classification E-value
Superfamily TPR-like 1.42e-29
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 213-328
Classification Level Classification E-value
Superfamily TPR-like 1.54e-23
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Weak hits

Sequence:  gi|28422198|gb|AAH46850|
Domain Number - Region: 104-148
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00824
Family N-terminal coiled coil domain from apc 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28422198|gb|AAH46850|
Sequence length 539
Comment Kns2-prov protein [Xenopus laevis]
Sequence
MYDNMSTMVYLKEEKLEKLTQDEIISKTKQVIQGLDALKNEHNSILHSLLETMKCLKKDD
ESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQRSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSDDKDSDSSKEPLDDLF
PNDDDDQGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYREAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREKFKGKQKDGTFGEYGSWYKACKVDSPTVTTTLKNLGALYRRQGKFE
AADTLEEAAMRSRKQALDNAHKQRVAEVLNDPESIEKRRSRESLDVVKYESGPDGGDEA
Download sequence
Identical sequences Q7ZWP7
NP_001080620.1.7800 XP_018087364.1.7800 gi|148231714|ref|NP_001080620| gi|28422198|gb|AAH46850|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]