SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28436918|gb|AAH46736| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28436918|gb|AAH46736|
Domain Number 1 Region: 35-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.28e-35
Family PDI-like 0.0000287
Further Details:      
 
Domain Number 2 Region: 372-483
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.72e-32
Family PDI-like 0.00086
Further Details:      
 
Domain Number 3 Region: 243-376
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.9e-28
Family PDI-like 0.016
Further Details:      
 
Domain Number 4 Region: 150-246
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-21
Family PDI-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28436918|gb|AAH46736|
Sequence length 517
Comment P4hb protein [Xenopus laevis]
Sequence
RTRGVLYTRFIMMRAVLLFGCALLVVARPDISEEKDVLVLKKDNFDEALKQYPYILVEFY
APWCGHCKALAPEYEKAAGILKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGD
KSSPKEYSAGREAADFVNWLKKRTGPAASTLSDEAAVAALVASSEVAVIGFFKDLESELA
KVFLQAAEAVDDVPFGITSSEAAFSKHELGKDGIVLFKKFDEGRNAFEGEITKEEVLSFI
KANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYQDKLENFKKAAASFKGKILFI
FIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESSDLSAEAIKEFCDRFLEG
KVKPHLMSQDVPEDWDKTPVKILVGKNFEEVVFDEEKNVFVEFYAPWCGHCKQLAPIWDQ
LGEKYKDHESIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKKVVDYNGERTQEGFSKF
LESGGQDGAADEDLEDLEEADETDLEEGDDIHTKDEL
Download sequence
Identical sequences Q7ZTJ5
gi|28436918|gb|AAH46736|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]