SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|2981641|gb|AAC24717| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|2981641|gb|AAC24717|
Domain Number 1 Region: 561-815
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.38e-88
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 31-303
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-78
Family Eukaryotic proteases 0.00052
Further Details:      
 
Domain Number 3 Region: 1290-1523
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.48e-73
Family Eukaryotic proteases 0.0000711
Further Details:      
 
Domain Number 4 Region: 439-541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 5 Region: 1128-1230
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-29
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 6 Region: 985-1093
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-27
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 7 Region: 315-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-22
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 8 Region: 842-956
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-20
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|2981641|gb|AAC24717|
Sequence length 1524
Comment polyprotein [Xenopus laevis]
Sequence
MMVSITLLLWVAACISAKISNLEPQQESPIPGETAELKCGTRPEIGDEPDLEFTSRIVGG
GDAAVGGQPWTVSLKLNERHICGGSIVRKDMVVTAAHCVYPVTEIKVSHMTVIVGEYDQQ
VMDSQEQSIPVSHIEPHPNYRGDGNMGYDIALVFLSKPIIFGSQVQPICLPQVGEKIEAG
TLCVSSGWGRLEENGDLSPVLQEVKLPVVDNGTCHAVLEPIGHPVLDDTMLCAGFPEGGM
DACQGDSGGPFVCRRRSGVWFLAGCVSWGLGCGRSWGAKQIIRSQSGSPAIFSRVSSVLD
FLRPPKLTGGCSSKGRTITGKNGTVRYPLSGNYSINSVCRWMLAVQKAKTIEIRFLQLDI
EDHATCTFDYLSFTVNEKMIRKVCGSTIPSPLIVRSNKVTVTFFSDGTFTGRGFEIQFLA
IPTKAASACGSAKILKKKGMIYSPNYPDPYPRLKTCSWIIEAPENHIVKLKFEDFNVEYG
HGCIYDAVEVYDGAEEKQLIARLCGYTLPLPISSPENTMLIRFKTDMENSYPGFKVKFSF
VPKEKQFSLPVDDTPTISMLHPRAIALDVCGMAPMTPKWWLPRIVGGEEASPNSWPWQVQ
IFFLRTFHCEGAIISPQWILTAAHCIRAAEPSYWTVIAGDHNRMLNESTEQIRNIKTIRI
HDNYNSETYDNDIALLYLEEPLDLNDFVRPVCLPEPEEVLTPASVCVVTGWGNTAEDGQP
ALGLQQLQLPILDSIICNTSYYSGELTDHMLCAGFPSSKEKDACQGDSGGPLVCQNEKEQ
FSIYGLVSWGEGCGRVSKPGVYTKVRLFFTWIQNTQQDLQQENALLNSKSVEQREGKAAG
GCSSDVLVEELVGLIASPGYPFGYAGGLRCSWVIEAAPFSIIKLTLKDLSIEESEDCLNE
FLAIYLNDSIDKKVTRCGSLHNKVTYSSSAQRVGVHFQSGDGGSNRNQGFFLQYWIYSVQ
VPDLAEFTGLSQGPRYGSSCEDVILTSSEGVIESPNYLGNYPDDLHCQWRIIAPVGKVIR
VDLLELKTEKDVSGCQDPLLVYNGIGESKDLLGVYCGEIRSISLKSEGSEITLIFTSNSE
VSGKGFSLKYSFWDKQAGSKQLEENAASVGCPALDLIQPESMEPGSAELESPNFPSLYSN
EMDCQWIIYSKYGKKLQIEVLYLNLEASPNCSWDYLNIYDGPNNSSHLLASLCGHQQDLV
LHSNGTFVTLHFHSDKSVVDWGFKIQYGAVPEPSDTLRSLDVPESESDDSEPDESETKQQ
KDQCGNTTVDPMMLYMARSGKIRNLNKGGKESGRVVGGQQAAPRSWPWLVSIQNSKKRHY
CGGIIITNKWILTAAHCEVKINLHRVVVGHTDLTEVQNEHAKVYNSHVHELYMPGSSPPR
NDLLLLELDTPLLLNNSVAVICLPDDVTTDWTQAECLVAGWGVTDVGGMSLPTKLQQAKV
PIVSTKKCKDYWVSDVTDNNICAGKAGASSCMGDSGGPLICKREDRYYLVGVVSWGSGKC
DVKAPSVYTLTSAFMDWISQHMDT
Download sequence
Identical sequences Q91674
NP_001082037.1.7800 gi|148234080|ref|NP_001082037| gi|2981641|gb|AAC24717|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]