SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32170691|gb|BAC78389| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|32170691|gb|BAC78389|
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000976
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32170691|gb|BAC78389|
Sequence length 41
Comment protein disulfide isomerase A2 precursor [Xenopus laevis]
Sequence
IRGFPNLRFFPAGPERKMIEYTKERTVELFSAFIDSGGVLP
Download sequence
Identical sequences Q7T2H5
gi|32170691|gb|BAC78389|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]