SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32450243|gb|AAH54254| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32450243|gb|AAH54254|
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.00045
Further Details:      
 
Domain Number 2 Region: 281-310
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000105
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 251-280
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000238
Family LIM domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|32450243|gb|AAH54254|
Sequence length 325
Comment MGC64465 protein [Xenopus laevis]
Sequence
MATKRVLMTGPSPWGFRLIGGKDFEQPLTISRVMPGSKAAVAELCTGDVVIAIDGENTDG
MTHLEAQNKIKGCEDELILTINRVESKIWSPLVSEDGKPNPYKMNLASNPQELKQIGTAH
NRSAMPFTAASASSTPKVITAQYNNPAGLYSSDNIQDFNSALETKATSSAPAPSKAAEQT
QPANTQHIDKDSEVYKMLQENRESEEPPRQSASFLVLQEILETDEKGEKPSGFRSVRAPT
NKVAASLGSGQKLQICDHCGSGIVGAFVKIRDKPRHPECYVCTDCGMNLKQKGHFFVEDT
MYCEKHARERMTPPEGYDVVTVFPK
Download sequence
Identical sequences Q7SYV2
NP_001082677.1.7800 gi|148236741|ref|NP_001082677| gi|32450243|gb|AAH54254|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]