SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|32484263|gb|AAH54190| from Xenopus laevis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32484263|gb|AAH54190|
Domain Number 1 Region: 275-436
Classification Level Classification E-value
Superfamily eEF1-gamma domain 6.02e-70
Family eEF1-gamma domain 0.0000000622
Further Details:      
 
Domain Number 2 Region: 81-239
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.39e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 2-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32484263|gb|AAH54190|
Sequence length 436
Comment MGC64329 protein [Xenopus laevis]
Sequence
MAGGTLYTYPDNWRAYKPLIAAQYSGFPIKVASSAPEFQFGVTNKTPEFLKKFPLGKVPA
FEGKDGFCLFESSAIAHYVGNDELRGTTRLHQAQVIQWVSFSDSHIVPPASAWVFPTLGI
MQYNKQATEQAKEEIKTVLGVLDSHLQTRTFLVGERITLADITVTCSLLWLYKQVLEPSF
RQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQPKKETPKKEKPAKEP
KKEKEEKKKAAPTPAPAPEDDLDESEKALAAEPKSKDPYAHLPKSSFIMDEFKRKYSNED
TLTVALPYFWEHFDKEGWSIWYAEYKFPEELTQAFMSCSLITGMFQRLDKLRKTGFASVI
LFGTNNNSSISGVWVFRGQDLAFTLSEDWQIDYESYNWRKLDSGSEECKTLVKEYFAWEG
EFKNVGKPFNQGKIFK
Download sequence
Identical sequences Q7SZ09
NP_001079766.1.7800 gi|147902635|ref|NP_001079766| gi|32484263|gb|AAH54190|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]